BIF401 Assignment No.2 Spring2020



                  Virtual University of Pakistan

Department of Bioinformatics & Computational Biology
Bioinformatics - I (BIF401)
Assignment No. 2                                                                                                                                        SPRING2020
                                                                                                                                    Total Marks: 25
Due Date: 11:59 PM, 16th August 2020
Note: Every section has different marks. Please try to do your own work as the copied results will get no marks.
Question:
1-   Take a candidate human gene/protein amino acid sequence (Use NCBI/UniProt or other databases and save the sequence at least 10kbp in Fasta format).
sex comb on midleg-like protein 4 isoform a [Homo sapiens]
>NP_932347.2 sex comb on midleg-like protein 4 isoform a [Homo sapiens]
MQSQRIPGRKRGRPSLHSTPMKMAVHNLYSASAGSLPAVKIPKKRGRKPGYKIKSRVLMTPLALSPPRST
PEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACID
CAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRG
CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLG
GGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCASSPSQDAQDARRPRSRNPSAWTVED
VVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKLCYHIDKLKQAKF


Click Here To View

Click Here to Download File

0/Post a Comment/Comments

Previous Post Next Post